top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|93000511|93014909|+|6|circRNA|CHD2|ENST00000626874.2|32,33,34,35,36,37

CHD2

Open Reading Frame (ORF)

LISQSHTSHNLHPQKPHLPASHGPQMHGHPRDNYNHPNKRHFSNAGQIKEAEASGKEGKQSAQAERGAWN

Peptide

EGKQSAQAER

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page