top of page

CircRNA

Gene

chr15|92967324|92985673|+|10|circRNA|CHD2|ENST00000626874.2|17,18,19,20,21,22,23,24,25,26

CHD2

Open Reading Frame (ORF)

MTVTLTLSLRGRPRDPLLLRVKRKTLMMTRSQSAEGVRGVCGRTSWRDLLMQRSEGLNFGKILKKTMGRGEKMATRVFIRC

Peptide

DLLMQRSEGLNFGK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page