top of page

CircRNA

Gene

chr15|91915992|91916458|+|1|circRNA|SLCO3A1|ENST00000318445.10|2

SLCO3A1

Open Reading Frame (ORF)

LRRHRHGAGRAAVGAARVPDPPVQVRGGRDPLGRRGPRRLRSQRLGRRRGARPRPHLPQPDGYQHDVLAAHWGPGAPGHRCYPCAAPGRLLHRRPRAEEGLLALYR

Peptide

HGAGRAAVGAAR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page