top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|90217438|90221765|+|6|circRNA|SEMA4B|NM_020210|3,4,5,6,7,8

SEMA4B

Open Reading Frame (ORF)

LWPQPTFLRAWAACKAMMTRSTFSSARLARNLSSLRTPLCPALPASARL

Peptide

LARNLSSLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page