top of page

CircRNA

Gene

chr15|85575130|85693451|+|12|circRNA|AKAP13|NM_006738|6,7,8,9,10,11,12,13,14,15,16,17

AKAP13

Open Reading Frame (ORF)

MKPFTNKDAYTCARRMLENQTPGAVYPMKYRMETVL

Peptide

RMLENQTPGAVYPMK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page