top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|78470531|78471924|+|2|circRNA|IREB2|NM_004136|6,7

IREB2

Open Reading Frame (ORF)

MAHQINLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGILGWDLKQC

Peptide

DLLFPDSVVGTDSHITMVNGLGILGWDLK

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page