top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|77158502|77182040|-|2|circRNA|PEAK1|ENST00000560626.6|5,4

PEAK1

Open Reading Frame (ORF)

LLVTPLLNMFGNLVNARIALNLKVCTSFPQTLRRHPSPMAM

Peptide

VCTSFPQTLRR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page