top of page

CircRNA

Gene

chr15|76728594|76771954|-|8|circRNA|SCAPER|ENST00000563290.5|17,16,15,14,13,12,11,10

SCAPER

Open Reading Frame (ORF)

LAVFETIMFELLKYLLSTLIQSVFQLCCKLVHLLYK

Peptide

LAVFETIMFELLK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page