top of page

CircRNA

Gene

chr15|74620225|74622118|+|1|ciRNA|CLK3|ENST00000345005.8|3

CLK3

CircRNA UID

ciCLK3(3)

Open Reading Frame (ORF)

LHPPLRLICTPLPKGPQSGVPHRTGGFACQPAQTGNFPSDLQPGPLQPSLFTRGSRGEEGQVPV

Peptide

GEEGQVPV

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page