top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|71242648|71256715|+|2|circRNA|THSD4|ENST00000355327.7|5,6

THSD4

Open Reading Frame (ORF)

MGRFYEWEPFAEGAGPVVPLALASMAMVRPHISYHCRQTLHTRHRGSGDRSSHPAIPGPREHLLLGMATVHQPTRSPNMGLCTKVTVALALDCRLRRPPSTSYL

Peptide

QTLHTRHR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page