top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|68141945|68173892|+|3|rescued|PIAS1|ENST00000249636|85,105,77|0,344,31870

PIAS1

Open Reading Frame (ORF)

MNEKKPTWVCPVCDKKAPYEHLIIDGIRQQSALSRNLFCICLDTTTSAANQ

Peptide

QQSALSR

ORF Found in Long-Read

true

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page