top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|65463760|65512564|-|14|circRNA|DPP8|ENST00000341861.9|15,14,13,12,11,10,9,8,7,6,5,4,3,2

DPP8

Open Reading Frame (ORF)

LTILLQKFSLLKVLLDLHCMGCSTSLMIYSLERNILLCCSYMVVLRKMQHGSSNGNRTAGC

Peptide

NILLCCSYMVVLRK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page