top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|63686358|63716473|-|13|circRNA|HERC1|ENST00000443617.6|34,33,32,31,30,29,28,27,26,25,24,23,22

HERC1

Open Reading Frame (ORF)

LGAISGRYQKTRTLQMLILRSIHLLELLMKKLKWKNRLRETGKRGIRSQRMKRRNGNMK

Peptide

LGAISGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page