top of page

CircRNA

Gene

chr15|63071275|63071657|-|1|ciRNA|RP11-244F12.2|ENST00000558905.1|1

RP11-244F12.2

Open Reading Frame (ORF)

LNGTSSALVRIPTLTKHTVLLNSLQSVAASTREMAHLNQDRPDMGLPFCMCFPHPLT

Peptide

LNGTSSALVR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page