top of page

CircRNA

Gene

chr15|60442415|60468322|-|9|circRNA|ICE2|ENST00000261520.8|12,11,10,9,8,7,6,5,4

ICE2

Open Reading Frame (ORF)

MSRQLVQQLKQRKKLKPQLEWFFFQNQEFLILVSLVSHRESRGVMWTCWLNTQRFLQIPKLLE

Peptide

MSRQLVQQLK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page