top of page

CircRNA

Gene

chr15|59195460|59214720|-|7|circRNA|MYO1E|ENST00000288235.8|17,16,15,14,13,12,11

MYO1E

CircRNA UID

circMYO1E(17,16,15,14,13,12,11)

Open Reading Frame (ORF)

LMKCTPHYIRCIKPNETKKPRDWEESSPSIKPWRKTMKNTTLAS

Peptide

DWEESSPSIKPWRK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page