top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|58621470|58627883|-|2|circRNA|ADAM10|ENST00000260408.7|11,10

ADAM10

Open Reading Frame (ORF)

MVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSMILEQSAHQENLRIWVKKKMAITSCMQEQHLGTNLTTINSHSVVLEI

Peptide

KMAITSCMQEQHLGTNLTTINSHSVVLEI

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

29

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page