top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|57262093|57263274|+|2|circRNA|TCF12|ENST00000438423.6|17,18

TCF12

Open Reading Frame (ORF)

MMNPPKKISRFHLEAEQGWNSSGRLCQSQWQSFSPV

Peptide

ISRFHLEAEQGWNSSGR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page