top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|52242047|52247592|-|6|circRNA|MYO5C|NM_018728|20,19,18,17,16,15

MYO5C

Open Reading Frame (ORF)

LGSHNHSEALPRVSCSQPVSVDSHGHHHNAGLQPRIPGKEEVSKVSSLCQLFSRKSNSSFSFWFNDYS

Peptide

LGSHNHSEALPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page