top of page

CircRNA

Gene

chr15|51766372|51777018|+|4|circRNA|TMOD2|NM_001142885|2,3,4,5

TMOD2

CircRNA UID

circTMOD2(2,3,4,5)

Open Reading Frame (ORF)

LKSQETGPFKCAWPMRKAYKKPWHSPFKKSWRNTRTLMKMSFLANSQKRN

Peptide

LKSQETGPFK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page