top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|43015687|43022801|-|4|circRNA|UBR1|ENST00000290650.8|29,28,27,26

UBR1

Open Reading Frame (ORF)

MIKKKQNEKEKLKLLGYIARRSWLRCLPYRKTSLKLINSCMTIHQKCLGKKIPLWRKRGFSYSGIGFTRREATASKSS

Peptide

RGFSYSGIGFTR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page