top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|41696074|41736698|+|11|circRNA|MGA|ENST00000545763.5|3,4,5,6,7,8,9,10,11,12,13

MGA

Open Reading Frame (ORF)

MIWLRNLDQRLLMVHCPLGKWRISLLCRQMPWIQ

Peptide

LLMVHCPLGKWR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page