top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|41055246|41081073|-|11|circRNA|INO80|ENST00000361937.7|18,17,16,15,14,13,12,11,10,9,8

INO80

Open Reading Frame (ORF)

LLHFIMPTLFDSHEEFNEWFSKDIESHAENKSAIDESK

Peptide

DIESHAENKSAIDESK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page