top of page

CircRNA

Gene

chr15|40628610|40652105|+|10|circRNA|CASC5|ENST00000346991.9|13,14,15,16,17,18,19,20,21,22

CASC5

Open Reading Frame (ORF)

LSGMSLSGVMIKLYSPLFMTRYNSPSPLKSQLLTAVVKWNHSFSEILFVKRA

Peptide

LSGMSLSGVMIKLYSPLFMTR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page