top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|35373520|35538467|-|6|circRNA|DPH6|ENST00000256538.8|8,7,6,5,4,3

DPH6

Open Reading Frame (ORF)

LHLEDKWGLMNWIATCIRQWGTMPLTCMQKQWLFPSIAEP

Peptide

QWGTMPLTCMQK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page