top of page

CircRNA

Gene

chr15|101331851|101370523|-|3|circRNA|PCSK6|ENST00000611716.4|14,13,12

PCSK6

Open Reading Frame (ORF)

MEPHTVWHSRAPVPHLQCPSVPLADAGALSPRAGATQGCPVTLPGGSS

Peptide

AGATQGCPVTLPGGSS

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page