top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|99458278|99463578|-|4|circRNA|SETD3|ENST00000331768.9|6,5,4,3

SETD3

Open Reading Frame (ORF)

MTLLSTLKKMKFGIFSPHKLYMMSSASIKTQLDSTPTSIKSSRMQQSGAWPRKRVGRVCADPDSG

Peptide

SSRMQQSGAWPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page