top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|95103345|95108503|-|7|circRNA|DICER1|NM_001195573|20,19,18,17,16,15,14

DICER1

Open Reading Frame (ORF)

LTANLSSQFLTPLQLKMIITVSTAQLSLKMLHIKVLIEPPL

Peptide

VLIEPPL

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page