top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|92142163|92143294|+|2|circRNA|CPSF2|ENST00000298875.8|8,9

CPSF2

Open Reading Frame (ORF)

MSDKLMRCFEDKRNNPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPKNSIILTYRTTPGTLARFLIDNPSEKITEIEQMSWKHFEVMEMC

Peptide

ITEIEQMSWK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page