top of page

CircRNA

Gene

chr14|88657375|88688359|-|10|circRNA|EML5|ENST00000553281.5|20,19,18,17,16,15,14,13,12,11

EML5

CircRNA UID

circEML5(20,19,18,17,16,15,14,13,12,11)

Open Reading Frame (ORF)

MLGIKPHLQQKEPSIDERRCVYLERHLSCKNSESA

Peptide

EPSIDERR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page