top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|80914321|80939540|-|3|circRNA|CEP128|ENST00000555265.5|4,3,2

CEP128

Open Reading Frame (ORF)

LRQVDQMLGRYREYSNGQAGAIEHVVWGKCRGNQRSSA

Peptide

EYSNGQAGAIEHVVWGKCR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page