top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|75863666|75902224|+|3|circRNA|TTLL5|NM_015072|29,30,31

TTLL5

Open Reading Frame (ORF)

MDSRAALTLQPLCPSPALQEPADRGICLGRRSRKQRVQPGYRGGPPAQVSPHSRQLSASICPAAT

Peptide

AALTLQPLCPSPALQEPADR

ORF Found in Long-Read

true

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page