top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|73970009|73988172|-|12|circRNA|ENTPD5|ENST00000557325.5|15,14,13,12,11,10,9,8,7,6,5,4

ENTPD5

Open Reading Frame (ORF)

LENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQPLQVCEQDCFCNKSLHPATSWEKNGHFLGHSLFHAGGILCLQRCLPQEPADLV

Peptide

NGHFLGHSLFHAGGILCLQRCLPQEPADLV

ORF Found in Long-Read

false

Peptide Length

30

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

30

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page