top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|71650334|71661467|+|3|circRNA|SIPA1L1|NM_001284245|5,6,7

SIPA1L1

Open Reading Frame (ORF)

LFSKSLEHSHSAQKTSDPTSSTFSSSSGCTIRALTVSVIAELPAESRHHVLQSWTEH

Peptide

ALTVSVIAELPAESR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page