top of page

CircRNA

Gene

chr14|69703394|69709104|+|3|circRNA|SUSD6|NM_014734|3,4,5

SUSD6

Open Reading Frame (ORF)

LGTRSPSWWMESRLHYHHTRRLYMAVLVTVCHLLTPEYRLCCQKGLGPVGGACQGSNSCRTKGPAPLQVEKMRPQASLDYVKPGALGPQRL

Peptide

LHYHHTRR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page