top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|67766226|67772210|-|5|circRNA|ZFYVE26|ENST00000347230.8|32,31,30,29,28

ZFYVE26

Open Reading Frame (ORF)

LCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLLTDIMKQLLFSAKMMFVKAGQSQDLALCDRYLQYTFP

Peptide

AGQSQDLALCDR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page