top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|64139940|64152716|+|6|circRNA|SYNE2|NM_015180|80,81,82,83,84,85

SYNE2

Open Reading Frame (ORF)

LKQSYLTLESGAVPLLEDTASRIDELFQKRSSVLTQL

Peptide

SSVLTQL

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page