top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|37247102|37270525|+|5|circRNA|MIPOL1|ENST00000396294.6|4,5,6,7,8

MIPOL1

Open Reading Frame (ORF)

LAKEDKEQRKLKFKLELQEKETEAKIAEKTAANPKVNEKLRKRLPIPNQHI

Peptide

IAEKTAANPK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page