top of page

CircRNA

Gene

chr14|31112415|31119866|-|7|circRNA|HECTD1|ENST00000554882.5|10,9,8,7,6,5,4

HECTD1

Open Reading Frame (ORF)

LALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRKKKSTKLKEDAGEHGMMIMC

Peptide

LKEDAGEHGMMIMC

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page