top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|20343070|20343411|-|1|circRNA|RPPH1|NR_002312|1

RPPH1

Open Reading Frame (ORF)

LGRSETRARGGPNRALPELRGGEFPENGAPREVRLGRRCRGPRPSGRGPADASFAGAWNRLTASEVSSMAEVRYPAGDLITQFRLLSSAHYRAEGSSSVGPRAECVLSLHSHVPWEGLRLGPEAALTGLSLSFGEVSSQRTGLRARSDWAGDAVDPALRGGARRMPPLPELGTDSRPAK

Peptide

SDWAGDAVDPALR

ORF Found in Long-Read

true

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page