top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|105469498|105469816|+|1|ciRNA|MTA1|ENST00000435036.6|20

MTA1

Open Reading Frame (ORF)

MMGYGALTHELSGVLGRGLASPARCHVEASRRPGKTRGAAACGGHGPCARPSGVRPTSPQGCPGPGWGSV

Peptide

GLASPAR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page