top of page

CircRNA

Gene

chr14|103675551|103679545|+|4|circRNA|RP11-73M18.2|ENST00000472726.2|13,14,15,16

RP11-73M18.2

Open Reading Frame (ORF)

LTMFTNRGWQKCSMTLRTWRSAGAVRASTWTWSSTRVALTEGRK

Peptide

TWRSAGAVR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page