top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|103491776|103500200|+|3|circRNA|MARK3|NM_001128918|15,16,17

MARK3

Open Reading Frame (ORF)

LNMRGTGDMRAQALFLIRELQLLQHTVSVVQPPQIESASQEALPVVALSTASPGNGEPQHIMALLPLPACPMKPHHCPRLEAEAPLISLVN

Peptide

GTGDMRAQALFLIR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page