top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|102974015|102981021|-|5|circRNA|CDC42BPB|NM_006035|12,11,10,9,8

CDC42BPB

Open Reading Frame (ORF)

LRTQWRFAKSVRTPRSGCGGWRSSTAWSGRRRRSCTRSDSSSHPMSRMYLKKRRTSSRD

Peptide

TPRSGCGGWR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page