top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|102434234|102452627|+|8|circRNA|TECPR2|NM_001172631|9,10,11,12,13,14,15,16

TECPR2

Open Reading Frame (ORF)

LCLPASAGPQVLNSGCLGPELMKAAPWSPAKSRTS

Peptide

LCLPASAGPQVLNSGCLGPELMK

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page