top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr14|102007007|102022880|+|16|circRNA|DYNC1H1|ENST00000360184.8|28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43

DYNC1H1

Open Reading Frame (ORF)

LKHFPNIDREKAMSRPILYSNWLSKDLLELGKQSLSKLLAISLDGLF

Peptide

DLLELGK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page