top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|77918090|77918624|-|1|circRNA|EDNRB|ENST00000377211.8|2

EDNRB

Open Reading Frame (ORF)

LEQVAACSRLQVCADAPWLRWFLPAACRGSGERREASRLTGPLRFCKPQR

Peptide

LQVCADAPWLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page