top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|52658398|52680155|+|10|circRNA|SUGT1|NM_001130912|4,5,6,7,8,9,10,11,12,13

SUGT1

Open Reading Frame (ORF)

LVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFLLLLMQRSL

Peptide

SFLLLLMQR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page