top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|45959482|45969971|-|5|circRNA|ZC3H13|ENST00000242848.8|18,17,16,15,14

ZC3H13

Open Reading Frame (ORF)

LYDLKNLVLLVPRTSQKTDRVDGKRRIVNQKGKRVQGATKNRNSRRKFLL

Peptide

VQGATKNR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page