top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|45492250|45493345|+|1|ciRNA|COG3|NM_031431|11

COG3

Open Reading Frame (ORF)

LLDSELLKQKLFIELLSAFPLSFYNVLRYYFPVDTYCSY

Peptide

LFIELLSAFPLSFYNVLR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page